Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [268991] (2 PDB entries) |
Domain d4v02b_: 4v02 B: [268995] automated match to d1hyqa_ complexed with atp, mg |
PDB Entry: 4v02 (more details), 2.7 Å
SCOPe Domain Sequences for d4v02b_:
Sequence, based on SEQRES records: (download)
>d4v02b_ c.37.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]} aevivitsgkggvgkttltanigtalaklgkkvllidaaiglrnldmilglenrivydil dvlegrvpyekalvkdkrglslwllpanqrankdvidiekwnktveeiknsgnydyilvd spagiekgfqiavspadkalivvnpevssirdadrvigllesmdkrnykvivnrikwemv krgamlsvedivdilkaeiigiipeepklvdftnrgepivldekfpasqaiidtarrlmg esiplkryg
>d4v02b_ c.37.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]} aevivitsgkggvgkttltanigtalaklgkkvllidaaiglrnldmilglenrivydil dvlegrvpyekalvkdkrglslwllpavidiekwnktveeiknsgnydyilvdspagiek gfqiavspadkalivvnpevssirdadrvigllesmdkrnykvivnrikwemvkrgamls vedivdilkaeiigiipeepklvdftnrgepivldekfpasqaiidtarrlmgesiplkr yg
Timeline for d4v02b_: