Lineage for d4v02a_ (4v02 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2113934Species Aquifex aeolicus [TaxId:63363] [268991] (2 PDB entries)
  8. 2113937Domain d4v02a_: 4v02 A: [268992]
    automated match to d1hyqa_
    complexed with atp, mg

Details for d4v02a_

PDB Entry: 4v02 (more details), 2.7 Å

PDB Description: MinC:MinD cell division protein complex, Aquifex aeolicus
PDB Compounds: (A:) site-determining protein

SCOPe Domain Sequences for d4v02a_:

Sequence, based on SEQRES records: (download)

>d4v02a_ c.37.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
aevivitsgkggvgkttltanigtalaklgkkvllidaaiglrnldmilglenrivydil
dvlegrvpyekalvkdkrglslwllpanqrankdvidiekwnktveeiknsgnydyilvd
spagiekgfqiavspadkalivvnpevssirdadrvigllesmdkrnykvivnrikwemv
krgamlsvedivdilkaeiigiipeepklvdftnrgepivldekfpasqaiidtarrlmg
esiplkryge

Sequence, based on observed residues (ATOM records): (download)

>d4v02a_ c.37.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
aevivitsgkggvgkttltanigtalaklgkkvllidaaiglrnldmilglenrivydil
dvlegrvpyekalvkdkrglslwllpadvidiekwnktveeiknsgnydyilvdspagie
kgfqiavspadkalivvnpevssirdadrvigllesmdkrnykvivnrikwemvkrgaml
svedivdilkaeiigiipeepklvdftnrgepivldekfpasqaiidtarrlmgesiplk
ryge

SCOPe Domain Coordinates for d4v02a_:

Click to download the PDB-style file with coordinates for d4v02a_.
(The format of our PDB-style files is described here.)

Timeline for d4v02a_: