SCOPe 2.05: Domain d4enga_: 4eng A:

Lineage for d4enga_ (4eng A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families)

5. Family b.52.1.1: Eng V-like [50686] (2 proteins)

6. Protein Endoglucanase V (Eng V) [50687] (2 species)

7. Species Fungus (Humicola insolens) [TaxId:34413] [50688] (4 PDB entries)

8. Domain d4enga_: 4eng A: [26898]
   complexed with ctr

Details for d4enga_

PDB Entry: 4eng, 1.9 Å

PDB Description: structure of endoglucanase v cellohexaose complex

PDB Compounds: (A:) endoglucanase v cellohexaose complex

SCOPe Domain Sequences for d4enga_:

Sequence; same for both SEQRES and ATOM records:

>d4enga_ b.52.1.1 (A:) Endoglucanase V (Eng V) {Fungus (Humicola insolens) [TaxId: 34413]}
adgrstrywncckpscgwakkapvnqpvfscnanfqritdfdaksgcepggvayscadqt
pwavnddfalgfaatsiagsneagwccacyeltftsgpvagkkmvvqststggdlgsnhf
dlnipgggvgifdgctpqfgglpgqryggissrnecdrfpdalkpgcywrfdwfknadnp
sfsfrqvqcpaelvartgcrrnddgnfpav

Timeline for d4enga_:

• d4enga_ first appeared (with stable ids) in SCOP 1.55, called d4eng__
  
• d4enga_ appears in SCOPe 2.04
  
• d4enga_ appears in SCOPe 2.06
  
• d4enga_ appears in the current release, SCOPe 2.08