Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (30 species) not a true protein |
Species Granulicella tundricola [TaxId:940615] [268964] (1 PDB entry) |
Domain d4uxas_: 4uxa S: [268979] automated match to d4bifa_ complexed with mn |
PDB Entry: 4uxa (more details), 2.1 Å
SCOPe Domain Sequences for d4uxas_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uxas_ b.82.1.0 (S:) automated matches {Granulicella tundricola [TaxId: 940615]} meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw mehvtdeqyrr
Timeline for d4uxas_: