Lineage for d3eng__ (3eng -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) 
Superfamily b.52.1: Barwin-like endoglucanases [50685] (2 families) 
Family b.52.1.1: Endoglucanase V [50686] (1 protein) Protein Endoglucanase V [50687] (1 species) Species Humicola insolens [50688] (4 PDB entries) 
Domain d3eng__: 3eng - [26897]
Details for d3eng__
PDB Entry: 3eng (more details), 1.9 Å
PDB Description: structure of endoglucanase v cellobiose complex
SCOP Domain Sequences for d3eng__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eng__ b.52.1.1 (-) Endoglucanase V {Humicola insolens}
adgrstrywdcckpscgwakkapvnqpvfscnanfqritdfdaksgcepggvayscadqt
pwavnddfalgfaatsiagsneagwccacyeltftsgpvagkkmvvqststggdlgsnhf
dlnipgggvgifdgctpqfgglpgqryggissrnecdrfpdalkpgcywrfdwfknadnp
sfsfrqvqcpaelvartgcrrnddgnfpavqip
SCOP Domain Coordinates for d3eng__:
Click to download the PDB-style file with coordinates for d3eng__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3eng__:
- d3eng__ appears in SCOP 1.57
- d3eng__ appears in the current release, SCOPe 2.08, called d3enga_
View in 3D