Lineage for d4uuqb_ (4uuq B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902215Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries)
  8. 2902372Domain d4uuqb_: 4uuq B: [268962]
    automated match to d3hjua_
    complexed with 64d

Details for d4uuqb_

PDB Entry: 4uuq (more details), 2.36 Å

PDB Description: crystal structure of human mono-glyceride lipase in complex with sar127303
PDB Compounds: (B:) Monoglyceride lipase

SCOPe Domain Sequences for d4uuqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uuqb_ c.69.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlphlvnadgqylfcrywkptgtpkalifvshgagehsgryeelarmlmgldllvfahdh
vghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmggaiailtaaerpg
hfagmvlisplvlanpesattfkvlaakvlnlvlpnlslgpidssvlsrnktevdiynsd
plicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdskgayllmelaksq
dktlkiyegayhvlhkelpevtnsvfheinmwvsqrta

SCOPe Domain Coordinates for d4uuqb_:

Click to download the PDB-style file with coordinates for d4uuqb_.
(The format of our PDB-style files is described here.)

Timeline for d4uuqb_: