Lineage for d1hd5a_ (1hd5 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061141Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2061142Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) (S)
  5. 2061143Family b.52.1.1: Eng V-like [50686] (3 protein domains)
  6. 2061147Protein Endoglucanase V (Eng V) [50687] (2 species)
  7. 2061148Species Fungus (Humicola insolens) [TaxId:34413] [50688] (4 PDB entries)
  8. 2061150Domain d1hd5a_: 1hd5 A: [26896]

Details for d1hd5a_

PDB Entry: 1hd5 (more details), 1.7 Å

PDB Description: endoglucanase from humicola insolens at 1.7a resolution
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d1hd5a_:

Sequence, based on SEQRES records: (download)

>d1hd5a_ b.52.1.1 (A:) Endoglucanase V (Eng V) {Fungus (Humicola insolens) [TaxId: 34413]}
adgkstrywdcckpscgwakkapvnqpvfscnanfqrltdfdaksgcepggvayscadqt
pwavnddfafgfaatsiagsneagwccacyeltftsgpvagkkmvvqststggdlgsnhf
dlnipgggvgifdgctpqfgglpgqryggissrnecdrfpdalkpgcywrfdwfknadnp
sfsfrqvqcpaelvartgcrrnddgnfpav

Sequence, based on observed residues (ATOM records): (download)

>d1hd5a_ b.52.1.1 (A:) Endoglucanase V (Eng V) {Fungus (Humicola insolens) [TaxId: 34413]}
adgkstrywdcckpscgwakkapvnqpvfscnanfqrltdfdaksgcepggvayscadqt
pwavnddfafgfaatsiagsneagwccacyeltftsgpvagkkmvvqststsnhfdlnip
gggvgifdgctpqfgglpgqryggissrnecdrfpdalkpgcywrfdwfknadnpsfsfr
qvqcpaelvartgcrrnddgnfpav

SCOPe Domain Coordinates for d1hd5a_:

Click to download the PDB-style file with coordinates for d1hd5a_.
(The format of our PDB-style files is described here.)

Timeline for d1hd5a_: