SCOPe 2.06: Domain d4utab2: 4uta B:298-391

Lineage for d4utab2 (4uta B:298-391)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Dengue virus 2 [TaxId:11060] [268950] (2 PDB entries)

8. Domain d4utab2: 4uta B:298-391 [268959]
   Other proteins in same PDB: d4utaa1, d4utaa3, d4utab1, d4utab3, d4utal1, d4utal2, d4utam1, d4utam2
   automated match to d4gsxa2

Details for d4utab2

PDB Entry: 4uta, 3 Å

PDB Description: crystal structure of dengue 2 virus envelope glycoprotein in complex with the fab fragment of the broadly neutralizing human antibody ede1 c8

PDB Compounds: (B:) envelope glycoprotein E

SCOPe Domain Sequences for d4utab2:

Sequence, based on SEQRES records:

>d4utab2 b.1.18.0 (B:298-391) automated matches {Dengue virus 2 [TaxId: 11060]}
sysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeitdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiivgvepgqlklnw

Sequence, based on observed residues (ATOM records):

>d4utab2 b.1.18.0 (B:298-391) automated matches {Dengue virus 2 [TaxId: 11060]}
sysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeikrhvlgrlitvnpivtek
dspvnieaeppfgdsyiivgvepgqlklnw

Timeline for d4utab2:

• d4utab2 first appeared in SCOPe 2.05
  
• d4utab2 appears in SCOPe 2.07
  
• d4utab2 appears in the current release, SCOPe 2.08