![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
![]() | Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) ![]() |
![]() | Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
![]() | Protein automated matches [227047] (11 species) not a true protein |
![]() | Species Dengue virus 2 [TaxId:11060] [268948] (2 PDB entries) |
![]() | Domain d4utab1: 4uta B:1-297 [268958] Other proteins in same PDB: d4utaa2, d4utaa3, d4utab2, d4utab3, d4utal1, d4utal2, d4utam1, d4utam2 automated match to d4gsxa1 |
PDB Entry: 4uta (more details), 3 Å
SCOPe Domain Sequences for d4utab1:
Sequence, based on SEQRES records: (download)
>d4utab1 f.10.1.0 (B:1-297) automated matches {Dengue virus 2 [TaxId: 11060]} mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc ieakltntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakft ckknmegkivqpenleytivitphsgeehavgndtgkhgkeikitpqsstteaeltgygt vtmecsprtgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
>d4utab1 f.10.1.0 (B:1-297) automated matches {Dengue virus 2 [TaxId: 11060]} mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc ieakltntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakft ckknmegkivqpenleytivitphsgeehhgkeikitpqsstteaeltgygtvtmecspr tgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtfknphakkq dvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
Timeline for d4utab1: