SCOPe 2.05: Domain d4utaa2: 4uta A:298-395

Lineage for d4utaa2 (4uta A:298-395)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (43 species)
   not a true protein

7. Species Dengue virus 2 [TaxId:11060] [268950] (2 PDB entries)

8. Domain d4utaa2: 4uta A:298-395 [268957]
   Other proteins in same PDB: d4utaa1, d4utab1, d4utal1, d4utal2, d4utam1, d4utam2
   automated match to d4gsxa2

Details for d4utaa2

PDB Entry: 4uta, 3 Å

PDB Description: crystal structure of dengue 2 virus envelope glycoprotein in complex with the fab fragment of the broadly neutralizing human antibody ede1 c8

PDB Compounds: (A:) envelope glycoprotein E

SCOPe Domain Sequences for d4utaa2:

Sequence, based on SEQRES records:

>d4utaa2 b.1.18.0 (A:298-395) automated matches {Dengue virus 2 [TaxId: 11060]}
sysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeitdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiivgvepgqlklnwlrpl

Sequence, based on observed residues (ATOM records):

>d4utaa2 b.1.18.0 (A:298-395) automated matches {Dengue virus 2 [TaxId: 11060]}
sysmctgkfkivkeiaetqhgtivirvqgspckipfeitdvlgrlitvnpivtekdspvn
ieaeppfgdsyiivlklnwlrpl

Timeline for d4utaa2:

• d4utaa2 is new in SCOPe 2.05-stable
  
• d4utaa2 appears in SCOPe 2.06
  
• d4utaa2 appears in the current release, SCOPe 2.08