Lineage for d4utca2 (4utc A:298-391)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766213Species Dengue virus 2 [TaxId:11060] [268950] (4 PDB entries)
  8. 2766217Domain d4utca2: 4utc A:298-391 [268953]
    Other proteins in same PDB: d4utca1, d4utca3, d4utcb1, d4utcb3
    automated match to d4gsxa2

Details for d4utca2

PDB Entry: 4utc (more details), 3.08 Å

PDB Description: crystal structure of dengue 2 virus envelope glycoprotein
PDB Compounds: (A:) envelope glycoprotein E

SCOPe Domain Sequences for d4utca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4utca2 b.1.18.0 (A:298-391) automated matches {Dengue virus 2 [TaxId: 11060]}
sysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeitdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiivgvepgqlklnw

SCOPe Domain Coordinates for d4utca2:

Click to download the PDB-style file with coordinates for d4utca2.
(The format of our PDB-style files is described here.)

Timeline for d4utca2: