Lineage for d4utcb2 (4utc B:298-391)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2033030Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2033031Protein automated matches [190226] (54 species)
    not a true protein
  7. 2033086Species Dengue virus 2 [TaxId:11060] [268950] (2 PDB entries)
  8. 2033090Domain d4utcb2: 4utc B:298-391 [268951]
    Other proteins in same PDB: d4utca1, d4utca3, d4utcb1, d4utcb3
    automated match to d4gsxa2

Details for d4utcb2

PDB Entry: 4utc (more details), 3.08 Å

PDB Description: crystal structure of dengue 2 virus envelope glycoprotein
PDB Compounds: (B:) envelope glycoprotein E

SCOPe Domain Sequences for d4utcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4utcb2 b.1.18.0 (B:298-391) automated matches {Dengue virus 2 [TaxId: 11060]}
sysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeitdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiivgvepgqlklnw

SCOPe Domain Coordinates for d4utcb2:

Click to download the PDB-style file with coordinates for d4utcb2.
(The format of our PDB-style files is described here.)

Timeline for d4utcb2: