| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Dengue virus 2 [TaxId:11060] [268950] (4 PDB entries) |
| Domain d4utcb2: 4utc B:298-391 [268951] Other proteins in same PDB: d4utca1, d4utca3, d4utcb1, d4utcb3 automated match to d4gsxa2 |
PDB Entry: 4utc (more details), 3.08 Å
SCOPe Domain Sequences for d4utcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4utcb2 b.1.18.0 (B:298-391) automated matches {Dengue virus 2 [TaxId: 11060]}
sysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeitdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiivgvepgqlklnw
Timeline for d4utcb2: