Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
Protein automated matches [227047] (6 species) not a true protein |
Species Dengue virus 2 [TaxId:11060] [268948] (2 PDB entries) |
Domain d4utcb1: 4utc B:1-297 [268949] Other proteins in same PDB: d4utca2, d4utca3, d4utcb2, d4utcb3 automated match to d4gsxa1 |
PDB Entry: 4utc (more details), 3.08 Å
SCOPe Domain Sequences for d4utcb1:
Sequence, based on SEQRES records: (download)
>d4utcb1 f.10.1.0 (B:1-297) automated matches {Dengue virus 2 [TaxId: 11060]} mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc ieakltntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakft ckknmegkivqpenleytivitphsgeehavgndtgkhgkeikitpqsstteaeltgygt vtmecsprtgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
>d4utcb1 f.10.1.0 (B:1-297) automated matches {Dengue virus 2 [TaxId: 11060]} mrcigisnrdfvegwvdivlehgscvttmaknkptldfelikteakqpatlrkycieakl tntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakftckknm egkivqpenleytivitphsgeehavgndtgkhgkeikitpqsstteaeltgygtvtmec sprtgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtfknpha kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
Timeline for d4utcb1: