Lineage for d4uegb_ (4ueg B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133793Family c.68.1.14: Glycogenin [75273] (2 protein domains)
  6. 2133841Protein automated matches [268942] (1 species)
    not a true protein
  7. 2133842Species Human (Homo sapiens) [TaxId:9606] [268943] (1 PDB entry)
  8. 2133844Domain d4uegb_: 4ueg B: [268944]
    automated match to d3t7nb_
    complexed with mg

Details for d4uegb_

PDB Entry: 4ueg (more details), 1.93 Å

PDB Description: Crystal structure of human glycogenin-2 catalytic domain
PDB Compounds: (B:) glycogenin-2

SCOPe Domain Sequences for d4uegb_:

Sequence, based on SEQRES records: (download)

>d4uegb_ c.68.1.14 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdqafvtlatndiycqgalvlgqslrrhrltrklvvlitpqvsdllrrilskvfdeviev
nlidsadyihlaflkrpelgltltklhcwtlthyskcvfldadtlvlsnvdelfdrgefs
aapdpgwpdcfnsgvfvfqpslhthklllqhamehgsfdgadqgllnsffrnwsttdihk
hlpfiynlssntmytyspafkqfgssakvvhflgsmkpwnykynpqsgsvleqgsvsssq
hqaaflhlwwtvyqnnvlplyk

Sequence, based on observed residues (ATOM records): (download)

>d4uegb_ c.68.1.14 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdqafvtlatndiycqgalvlgqslrrhrltrklvvlitpqvsdllrrilskvfdeviev
nlsadyihlaflkrpelgltltklhcwtlthyskcvfldadtlvlsnvdelfdrgefsaa
pdpgwpdcfnsgvfvfqpslhthklllqhamehgsfdgadqgllnsffrnwsttdihkhl
pfiynlssntmytyspafkqfgssakvvhflgsmkpwnykysvsssqhqaaflhlwwtvy
qnnvlplyk

SCOPe Domain Coordinates for d4uegb_:

Click to download the PDB-style file with coordinates for d4uegb_.
(The format of our PDB-style files is described here.)

Timeline for d4uegb_: