Lineage for d4ue3t_ (4ue3 T:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624627Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2624628Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2624800Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2624801Protein automated matches [191172] (11 species)
    not a true protein
  7. 2624833Species Escherichia coli [TaxId:562] [256126] (6 PDB entries)
  8. 2624841Domain d4ue3t_: 4ue3 T: [268940]
    Other proteins in same PDB: d4ue3l_, d4ue3m_
    automated match to d3rgws_
    complexed with cl, f3s, mg, nfv, sf3, sf4, so4

Details for d4ue3t_

PDB Entry: 4ue3 (more details), 1.4 Å

PDB Description: the mechanism of hydrogen activation by nife-hydrogenases and the importance of the active site arginine
PDB Compounds: (T:) Hydrogenase-1 large chain

SCOPe Domain Sequences for d4ue3t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ue3t_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 562]}
kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
qsghgclgcaengfwdrgsfysrvv

SCOPe Domain Coordinates for d4ue3t_:

Click to download the PDB-style file with coordinates for d4ue3t_.
(The format of our PDB-style files is described here.)

Timeline for d4ue3t_: