SCOPe 2.07: Domain d4ue3t_: 4ue3 T:

Lineage for d4ue3t_ (4ue3 T:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.0: automated matches [191636] (1 protein)
   not a true family

6. Protein automated matches [191172] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [256126] (6 PDB entries)

8. Domain d4ue3t_: 4ue3 T: [268940]
   Other proteins in same PDB: d4ue3l_, d4ue3m_
   automated match to d3rgws_
   complexed with cl, f3s, mg, nfv, sf3, sf4, so4

Details for d4ue3t_

PDB Entry: 4ue3, 1.4 Å

PDB Description: the mechanism of hydrogen activation by nife-hydrogenases and the importance of the active site arginine

PDB Compounds: (T:) Hydrogenase-1 large chain

SCOPe Domain Sequences for d4ue3t_:

Sequence; same for both SEQRES and ATOM records:

>d4ue3t_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 562]}
kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
qsghgclgcaengfwdrgsfysrvv

Timeline for d4ue3t_:

• d4ue3t_ first appeared in SCOPe 2.05
  
• d4ue3t_ appears in SCOPe 2.06
  
• d4ue3t_ appears in the current release, SCOPe 2.08