SCOP 1.59: Domain d1gaxb2: 1gax B:190-342

Lineage for d1gaxb2 (1gax B:190-342)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.51: ValRS/IleRS editing domain [50676] (1 superfamily)

4. Superfamily b.51.1: ValRS/IleRS editing domain [50677] (1 family)

5. Family b.51.1.1: ValRS/IleRS editing domain [50678] (2 proteins)

6. Protein Valyl-tRNA synthetase (ValRS) [50682] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50683] (1 PDB entry)

8. Domain d1gaxb2: 1gax B:190-342 [26894]
   Other proteins in same PDB: d1gaxa1, d1gaxa3, d1gaxb1, d1gaxb3

Details for d1gaxb2

PDB Entry: 1gax, 2.9 Å

PDB Description: crystal structure of thermus thermophilus valyl-trna synthetase complexed with trna(val) and valyl-adenylate analogue

SCOP Domain Sequences for d1gaxb2:

Sequence; same for both SEQRES and ATOM records:

>d1gaxb2 b.51.1.1 (B:190-342) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus}
teptpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkrariplte
vwipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpeal
rgldrfearrkavelfreaghlvkeedytiala

Timeline for d1gaxb2:

• d1gaxb2 first appeared (with stable ids) in SCOP 1.55
  
• d1gaxb2 appears in SCOP 1.57
  
• d1gaxb2 appears in SCOP 1.61
  
• d1gaxb2 appears in the current release, SCOPe 2.08