![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily) core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel |
![]() | Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) ![]() |
![]() | Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins) inserted into the catalytic domain |
![]() | Protein Valyl-tRNA synthetase (ValRS) [50682] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50683] (3 PDB entries) |
![]() | Domain d1gaxb2: 1gax B:190-342 [26894] Other proteins in same PDB: d1gaxa3, d1gaxa4, d1gaxa5, d1gaxb3, d1gaxb4, d1gaxb5 protein/RNA complex; complexed with vaa, zn |
PDB Entry: 1gax (more details), 2.9 Å
SCOPe Domain Sequences for d1gaxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gaxb2 b.51.1.1 (B:190-342) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} teptpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkrariplte vwipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpeal rgldrfearrkavelfreaghlvkeedytiala
Timeline for d1gaxb2:
![]() Domains from other chains: (mouse over for more information) d1gaxa2, d1gaxa3, d1gaxa4, d1gaxa5 |