Lineage for d4uaub_ (4uau B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883848Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1883849Protein automated matches [190447] (49 species)
    not a true protein
  7. 1884193Species Rhodobacter sphaeroides [TaxId:1063] [268925] (4 PDB entries)
  8. 1884199Domain d4uaub_: 4uau B: [268939]
    automated match to d1te2a_
    complexed with mes, mg, xbp; mutant

Details for d4uaub_

PDB Entry: 4uau (more details), 1.45 Å

PDB Description: crystal structure of cbby (mutant d10n) from rhodobacter sphaeroides in complex with xylulose-(1,5)bisphosphate, crystal form ii
PDB Compounds: (B:) Protein CbbY

SCOPe Domain Sequences for d4uaub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uaub_ c.108.1.0 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mieailfdvngtlaeteelhrrafnetfaalgvdwfwdreeyrelltttggkeriarflr
hqkgdpaplpiadihrakterfvalmaegeialrpgiadliaeakragirlavatttslp
nvealcracfghpareifdviaagdmvaekkpspdiyrlalreldvpperavaledslng
lraakgaglrcivspgfytrheefagadrlldsfaelgglagldl

SCOPe Domain Coordinates for d4uaub_:

Click to download the PDB-style file with coordinates for d4uaub_.
(The format of our PDB-style files is described here.)

Timeline for d4uaub_: