Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (49 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [268925] (4 PDB entries) |
Domain d4uaub_: 4uau B: [268939] automated match to d1te2a_ complexed with mes, mg, xbp; mutant |
PDB Entry: 4uau (more details), 1.45 Å
SCOPe Domain Sequences for d4uaub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uaub_ c.108.1.0 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} mieailfdvngtlaeteelhrrafnetfaalgvdwfwdreeyrelltttggkeriarflr hqkgdpaplpiadihrakterfvalmaegeialrpgiadliaeakragirlavatttslp nvealcracfghpareifdviaagdmvaekkpspdiyrlalreldvpperavaledslng lraakgaglrcivspgfytrheefagadrlldsfaelgglagldl
Timeline for d4uaub_: