Lineage for d4uara_ (4uar A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920636Species Rhodobacter sphaeroides [TaxId:1063] [268925] (4 PDB entries)
  8. 2920643Domain d4uara_: 4uar A: [268938]
    automated match to d1te2a_
    complexed with gol

Details for d4uara_

PDB Entry: 4uar (more details), 1.9 Å

PDB Description: crystal structure of apo-cbby from rhodobacter sphaeroides
PDB Compounds: (A:) Protein CbbY

SCOPe Domain Sequences for d4uara_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uara_ c.108.1.0 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mieailfdvdgtlaeteelhrrafnetfaalgvdwfwdreeyrelltttggkeriarflr
hqkgdpaplpiadihrakterfvalmaegeialrpgiadliaeakragirlavatttslp
nvealcracfghpareifdviaagdmvaekkpspdiyrlalreldvpperavaledslng
lraakgaglrcivspgfytrheefagadrlldsfaelgglagldl

SCOPe Domain Coordinates for d4uara_:

Click to download the PDB-style file with coordinates for d4uara_.
(The format of our PDB-style files is described here.)

Timeline for d4uara_: