Lineage for d4ue3l_ (4ue3 L:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624340Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2624341Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2624506Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 2624507Protein automated matches [191173] (15 species)
    not a true protein
  7. 2624536Species Escherichia coli [TaxId:562] [195685] (6 PDB entries)
  8. 2624543Domain d4ue3l_: 4ue3 L: [268935]
    Other proteins in same PDB: d4ue3s_, d4ue3t_
    automated match to d3uqyl_
    complexed with cl, f3s, mg, nfv, sf3, sf4, so4

Details for d4ue3l_

PDB Entry: 4ue3 (more details), 1.4 Å

PDB Description: the mechanism of hydrogen activation by nife-hydrogenases and the importance of the active site arginine
PDB Compounds: (L:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d4ue3l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ue3l_ e.18.1.0 (L:) automated matches {Escherichia coli [TaxId: 562]}
stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
latastekwepatwptecrgvgfteapkgalghwaairdgkidlyqcvvpttwnasprdp
kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth

SCOPe Domain Coordinates for d4ue3l_:

Click to download the PDB-style file with coordinates for d4ue3l_.
(The format of our PDB-style files is described here.)

Timeline for d4ue3l_: