Lineage for d1gaxa2 (1gax A:190-342)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1131794Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 1131795Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 1131796Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins)
    inserted into the catalytic domain
  6. 1131815Protein Valyl-tRNA synthetase (ValRS) [50682] (1 species)
  7. 1131816Species Thermus thermophilus [TaxId:274] [50683] (5 PDB entries)
  8. 1131821Domain d1gaxa2: 1gax A:190-342 [26893]
    Other proteins in same PDB: d1gaxa3, d1gaxa4, d1gaxa5, d1gaxb3, d1gaxb4, d1gaxb5
    protein/RNA complex; complexed with vaa, zn

Details for d1gaxa2

PDB Entry: 1gax (more details), 2.9 Å

PDB Description: crystal structure of thermus thermophilus valyl-trna synthetase complexed with trna(val) and valyl-adenylate analogue
PDB Compounds: (A:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1gaxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaxa2 b.51.1.1 (A:190-342) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]}
teptpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkrariplte
vwipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpeal
rgldrfearrkavelfreaghlvkeedytiala

SCOPe Domain Coordinates for d1gaxa2:

Click to download the PDB-style file with coordinates for d1gaxa2.
(The format of our PDB-style files is described here.)

Timeline for d1gaxa2: