Class b: All beta proteins [48724] (180 folds) |
Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily) core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel |
Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) |
Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins) inserted into the catalytic domain |
Protein Valyl-tRNA synthetase (ValRS) [50682] (1 species) |
Species Thermus thermophilus [TaxId:274] [50683] (3 PDB entries) |
Domain d1gaxa2: 1gax A:190-342 [26893] Other proteins in same PDB: d1gaxa3, d1gaxa4, d1gaxa5, d1gaxb3, d1gaxb4, d1gaxb5 protein/RNA complex; complexed with vaa, zn |
PDB Entry: 1gax (more details), 2.9 Å
SCOPe Domain Sequences for d1gaxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gaxa2 b.51.1.1 (A:190-342) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} teptpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkrariplte vwipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpeal rgldrfearrkavelfreaghlvkeedytiala
Timeline for d1gaxa2:
View in 3D Domains from other chains: (mouse over for more information) d1gaxb2, d1gaxb3, d1gaxb4, d1gaxb5 |