Lineage for d4u9da_ (4u9d A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1726514Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1726557Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1726558Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 1726569Protein automated matches [190502] (2 species)
    not a true protein
  7. 1726570Species Escherichia coli [TaxId:562] [187450] (34 PDB entries)
  8. 1726684Domain d4u9da_: 4u9d A: [268927]
    automated match to d3m79a_
    complexed with hem, zn

Details for d4u9da_

PDB Entry: 4u9d (more details), 2.5 Å

PDB Description: crystal structure of the zn-directed tetramer of the engineered cyt cb562 variant, ab3
PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d4u9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u9da_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlanegkvkeaqhaaeqlkctcnhchqkyr

SCOPe Domain Coordinates for d4u9da_:

Click to download the PDB-style file with coordinates for d4u9da_.
(The format of our PDB-style files is described here.)

Timeline for d4u9da_: