SCOPe 2.05: Domain d4u9ea_: 4u9e A:

Lineage for d4u9ea_ (4u9e A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein automated matches [190502] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (34 PDB entries)

8. Domain d4u9ea_: 4u9e A: [268924]
   automated match to d3m79a_
   complexed with ca, hem, zn

Details for d4u9ea_

PDB Entry: 4u9e, 2.8 Å

PDB Description: crystal structure of the zn-directed tetramer of the engineered cyt cb562 variant, a104/57g ab3

PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d4u9ea_:

Sequence, based on SEQRES records:

>d4u9ea_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspgmhd
frhgfwiligqihdalhlanegkvkeaqhaaeqlkctcnhchqayr

Sequence, based on observed residues (ATOM records):

>d4u9ea_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsmhdfrhgfwiligqihda
lhlanegkvkeaqhaaeqlkctcnhchqayr

Timeline for d4u9ea_:

• d4u9ea_ is new in SCOPe 2.05-stable
  
• d4u9ea_ appears in SCOPe 2.06
  
• d4u9ea_ appears in the current release, SCOPe 2.08