SCOPe 2.02: Domain d1qu3a2: 1qu3 A:201-394

Lineage for d1qu3a2 (1qu3 A:201-394)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
   core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel

4. Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family)

5. Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins)
   inserted into the catalytic domain

6. Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [50681] (3 PDB entries)

8. Domain d1qu3a2: 1qu3 A:201-394 [26892]
   Other proteins in same PDB: d1qu3a1, d1qu3a3
   protein/RNA complex; complexed with mrc, zn

Details for d1qu3a2

PDB Entry: 1qu3, 2.9 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin

PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1qu3a2:

Sequence; same for both SEQRES and ATOM records:

>d1qu3a2 b.51.1.1 (A:201-394) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]}
hdkrsasiyvafnvkddkgvvdadakfiiwtttpwtipsnvaitvhpelkygqynvngek
yiiaealsdavaealdwdkasiklekeytgkelewvvaqhpfldreslvingdhvttdag
tgcvhtapghgeddyivgqqyelpvispiddkgvfteeggqfegmfydkankavtdllte
kgallkldfithsy

Timeline for d1qu3a2:

• d1qu3a2 first appeared (with stable ids) in SCOP 1.55
  
• d1qu3a2 appears in SCOPe 2.01
  
• d1qu3a2 appears in SCOPe 2.03
  
• d1qu3a2 appears in the current release, SCOPe 2.08