Lineage for d1qu3a2 (1qu3 A:201-394)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113027Fold b.51: ValRS/IleRS editing domain [50676] (1 superfamily)
  4. 113028Superfamily b.51.1: ValRS/IleRS editing domain [50677] (1 family) (S)
  5. 113029Family b.51.1.1: ValRS/IleRS editing domain [50678] (2 proteins)
  6. 113030Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)
  7. 113031Species Staphylococcus aureus [TaxId:1280] [50681] (3 PDB entries)
  8. 113034Domain d1qu3a2: 1qu3 A:201-394 [26892]
    Other proteins in same PDB: d1qu3a1, d1qu3a3

Details for d1qu3a2

PDB Entry: 1qu3 (more details), 2.9 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin

SCOP Domain Sequences for d1qu3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qu3a2 b.51.1.1 (A:201-394) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus}
hdkrsasiyvafnvkddkgvvdadakfiiwtttpwtipsnvaitvhpelkygqynvngek
yiiaealsdavaealdwdkasiklekeytgkelewvvaqhpfldreslvingdhvttdag
tgcvhtapghgeddyivgqqyelpvispiddkgvfteeggqfegmfydkankavtdllte
kgallkldfithsy

SCOP Domain Coordinates for d1qu3a2:

Click to download the PDB-style file with coordinates for d1qu3a2.
(The format of our PDB-style files is described here.)

Timeline for d1qu3a2: