SCOPe 2.06: Domain d1ffya2: 1ffy A:201-394

Lineage for d1ffya2 (1ffy A:201-394)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
   core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel

4. Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family)

5. Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
   inserted into the catalytic domain

6. Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [50681] (3 PDB entries)

8. Domain d1ffya2: 1ffy A:201-394 [26891]
   Other proteins in same PDB: d1ffya1, d1ffya3
   protein/RNA complex; complexed with k, mg, mrc, zn

Details for d1ffya2

PDB Entry: 1ffy, 2.2 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin

PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1ffya2:

Sequence; same for both SEQRES and ATOM records:

>d1ffya2 b.51.1.1 (A:201-394) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]}
hdkrsasiyvafnvkddkgvvdadakfiiwtttpwtipsnvaitvhpelkygqynvngek
yiiaealsdavaealdwdkasiklekeytgkelewvvaqhpfldreslvingdhvttdag
tgcvhtapghgeddyivgqqyelpvispiddkgvfteeggqfegmfydkankavtdllte
kgallkldfithsy

Timeline for d1ffya2:

• d1ffya2 first appeared (with stable ids) in SCOP 1.55
  
• d1ffya2 appears in SCOPe 2.05
  
• d1ffya2 appears in SCOPe 2.07
  
• d1ffya2 appears in the current release, SCOPe 2.08