Lineage for d1ffya2 (1ffy A:201-394)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16129Fold b.51: ValRS/IleRS editing domain [50676] (1 superfamily)
  4. 16130Superfamily b.51.1: ValRS/IleRS editing domain [50677] (1 family) (S)
  5. 16131Family b.51.1.1: ValRS/IleRS editing domain [50678] (2 proteins)
  6. 16132Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)
  7. 16133Species Staphylococcus aureus [TaxId:1280] [50681] (3 PDB entries)
  8. 16134Domain d1ffya2: 1ffy A:201-394 [26891]
    Other proteins in same PDB: d1ffya1, d1ffya3

Details for d1ffya2

PDB Entry: 1ffy (more details), 2.2 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin

SCOP Domain Sequences for d1ffya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffya2 b.51.1.1 (A:201-394) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus}
hdkrsasiyvafnvkddkgvvdadakfiiwtttpwtipsnvaitvhpelkygqynvngek
yiiaealsdavaealdwdkasiklekeytgkelewvvaqhpfldreslvingdhvttdag
tgcvhtapghgeddyivgqqyelpvispiddkgvfteeggqfegmfydkankavtdllte
kgallkldfithsy

SCOP Domain Coordinates for d1ffya2:

Click to download the PDB-style file with coordinates for d1ffya2.
(The format of our PDB-style files is described here.)

Timeline for d1ffya2: