Lineage for d4u2hf_ (4u2h F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132636Species Micromonospora echinospora [TaxId:1877] [257603] (4 PDB entries)
  8. 2132650Domain d4u2hf_: 4u2h F: [268903]
    automated match to d4q31c_
    complexed with so4

Details for d4u2hf_

PDB Entry: 4u2h (more details), 1.85 Å

PDB Description: The crystal structure of apo CalE6, a methionine gamma lyase from Micromonospora echinospora
PDB Compounds: (F:) CalE6

SCOPe Domain Sequences for d4u2hf_:

Sequence, based on SEQRES records: (download)

>d4u2hf_ c.67.1.0 (F:) automated matches {Micromonospora echinospora [TaxId: 1877]}
msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
vgiedpqdlaedlsrala

Sequence, based on observed residues (ATOM records): (download)

>d4u2hf_ c.67.1.0 (F:) automated matches {Micromonospora echinospora [TaxId: 1877]}
msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqpryfygrgenptreeleecla
glerapfatvfssgqaaaatllslvrpgqcvvstgtdglfdlaarqgvrvryadlttpeg
iaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqqplalg
advslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrrglhtl
slrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfdylggp
aerlldrftlftcgvslggvhslvecpalmthrrgigeslirlsvgiedpqdlaedlsra
la

SCOPe Domain Coordinates for d4u2hf_:

Click to download the PDB-style file with coordinates for d4u2hf_.
(The format of our PDB-style files is described here.)

Timeline for d4u2hf_: