Class b: All beta proteins [48724] (174 folds) |
Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily) core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel |
Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) |
Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins) inserted into the catalytic domain |
Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [50681] (3 PDB entries) |
Domain d1qu2a2: 1qu2 A:201-394 [26890] Other proteins in same PDB: d1qu2a1, d1qu2a3 protein/RNA complex; complexed with k, mg, mrc, zn |
PDB Entry: 1qu2 (more details), 2.2 Å
SCOPe Domain Sequences for d1qu2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qu2a2 b.51.1.1 (A:201-394) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} hdkrsasiyvafnvkddkgvvdadakfiiwtttpwtipsnvaitvhpelkygqynvngek yiiaealsdavaealdwdkasiklekeytgkelewvvaqhpfldreslvingdhvttdag tgcvhtapghgeddyivgqqyelpvispiddkgvfteeggqfegmfydkankavtdllte kgallkldfithsy
Timeline for d1qu2a2: