SCOP 1.59: Domain d1qu2a2: 1qu2 A:201-394

Lineage for d1qu2a2 (1qu2 A:201-394)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.51: ValRS/IleRS editing domain [50676] (1 superfamily)

4. Superfamily b.51.1: ValRS/IleRS editing domain [50677] (1 family)

5. Family b.51.1.1: ValRS/IleRS editing domain [50678] (2 proteins)

6. Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [50681] (3 PDB entries)

8. Domain d1qu2a2: 1qu2 A:201-394 [26890]
   Other proteins in same PDB: d1qu2a1, d1qu2a3

Details for d1qu2a2

PDB Entry: 1qu2, 2.2 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin

SCOP Domain Sequences for d1qu2a2:

Sequence; same for both SEQRES and ATOM records:

>d1qu2a2 b.51.1.1 (A:201-394) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus}
hdkrsasiyvafnvkddkgvvdadakfiiwtttpwtipsnvaitvhpelkygqynvngek
yiiaealsdavaealdwdkasiklekeytgkelewvvaqhpfldreslvingdhvttdag
tgcvhtapghgeddyivgqqyelpvispiddkgvfteeggqfegmfydkankavtdllte
kgallkldfithsy

Timeline for d1qu2a2:

• d1qu2a2 first appeared (with stable ids) in SCOP 1.55
  
• d1qu2a2 appears in SCOP 1.57
  
• d1qu2a2 appears in SCOP 1.61
  
• d1qu2a2 appears in the current release, SCOPe 2.08