![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Micromonospora echinospora [TaxId:1877] [257603] (4 PDB entries) |
![]() | Domain d4u1te_: 4u1t E: [268894] automated match to d4q31c_ complexed with so4 |
PDB Entry: 4u1t (more details), 2 Å
SCOPe Domain Sequences for d4u1te_:
Sequence, based on SEQRES records: (download)
>d4u1te_ c.67.1.0 (E:) automated matches {Micromonospora echinospora [TaxId: 1877]} msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls vgiedpqdlaedlsralag
>d4u1te_ c.67.1.0 (E:) automated matches {Micromonospora echinospora [TaxId: 1877]} msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs fdylggpaerlldrftlftcgvslggvhslvecpalmgigeslirlsvgiedpqdlaedl sralag
Timeline for d4u1te_: