| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
| Family c.14.1.3: Crotonase-like [52103] (14 proteins) |
| Protein automated matches [190669] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187771] (5 PDB entries) |
| Domain d4u1aa_: 4u1a A: [268891] Other proteins in same PDB: d4u1ab2, d4u1ac2 automated match to d2f6qc_ complexed with cl; mutant |
PDB Entry: 4u1a (more details), 2.85 Å
SCOPe Domain Sequences for d4u1aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u1aa_ c.14.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltgngdyys
sgndltnftdippggveekaknnavllrefvgcfidfpkpliavvngpavgisvtllglf
davyasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaqglv
tevfpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgrwls
dec
Timeline for d4u1aa_:
View in 3DDomains from other chains: (mouse over for more information) d4u1ab1, d4u1ab2, d4u1ac1, d4u1ac2 |