![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.3: Crotonase-like [52103] (14 proteins) |
![]() | Protein automated matches [190669] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187771] (5 PDB entries) |
![]() | Domain d4u18c_: 4u18 C: [268889] Other proteins in same PDB: d4u18a2 automated match to d2f6qb_ complexed with cl, gol |
PDB Entry: 4u18 (more details), 2.64 Å
SCOPe Domain Sequences for d4u18c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u18c_ c.14.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gfetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltgngdyys sgndltnftdippggveekaknnavllrefvgcfidfpkpliavvngpavgisvtllglf davyasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaqglv tevfpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgrwls dectnavv
Timeline for d4u18c_: