Lineage for d4u18c_ (4u18 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853061Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2853276Protein automated matches [190669] (6 species)
    not a true protein
  7. 2853291Species Human (Homo sapiens) [TaxId:9606] [187771] (5 PDB entries)
  8. 2853306Domain d4u18c_: 4u18 C: [268889]
    Other proteins in same PDB: d4u18a2
    automated match to d2f6qb_
    complexed with cl, gol

Details for d4u18c_

PDB Entry: 4u18 (more details), 2.64 Å

PDB Description: Crystal structure of human peroxisomal delta3,delta2, enoyl-CoA isomerase (ISO-ECI2)
PDB Compounds: (C:) Enoyl-CoA delta isomerase 2, mitochondrial

SCOPe Domain Sequences for d4u18c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u18c_ c.14.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltgngdyys
sgndltnftdippggveekaknnavllrefvgcfidfpkpliavvngpavgisvtllglf
davyasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaqglv
tevfpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgrwls
dectnavv

SCOPe Domain Coordinates for d4u18c_:

Click to download the PDB-style file with coordinates for d4u18c_.
(The format of our PDB-style files is described here.)

Timeline for d4u18c_: