Lineage for d4tvma_ (4tvm A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004800Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2004801Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2004906Family a.103.1.0: automated matches [191476] (1 protein)
    not a true family
  6. 2004907Protein automated matches [190763] (6 species)
    not a true protein
  7. 2004914Species Mycobacterium tuberculosis [TaxId:83332] [268881] (1 PDB entry)
  8. 2004915Domain d4tvma_: 4tvm A: [268882]
    automated match to d4e6ya_
    complexed with oaa

Details for d4tvma_

PDB Entry: 4tvm (more details), 2.6 Å

PDB Description: Structure of Citrate Synthase from Mycobacterium tuberculosis
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d4tvma_:

Sequence, based on SEQRES records: (download)

>d4tvma_ a.103.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tatlrypggeidlqivhategadgialgpllaktghttfdvgfantaaakssityidgda
gilryrgypidqlaekstfievcylliygelpdtdqlaqftgriqrhtmlhedlkrffdg
fprnahpmpvlssvvnalsayyqdaldpmdngqvelstirllaklptiaayaykksvgqp
flypdnsltlvenflrltfgfpaepyqadpevvraldmlfilhadheqncststvrlvgs
sranlftsisgginalwgplhgganqavlemlegirdsgddvsefvrkvknreagvklmg
fghrvyknydprarivkeqadkilaklggddsllgiakeleeaaltddyfierklypnvd
fytgliyralgfptrmftvlfalgrlpgwiahwremhdegdskigrprqiytgyterdyv
ti

Sequence, based on observed residues (ATOM records): (download)

>d4tvma_ a.103.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tatlrypggeidlqivhategadgialgpllaktghttfdvgfantaaakssityidgda
gilryrgypidqlaekstfievcylliygelpdtdqlaqftgriqrhtmlhedlkrffdg
fprnahpmpvlssvvnalsayyqdaldpmdngqvelstirllaklptiaayaykksvgqp
flypdnsltlvenflrltfgfpaepyqadpevvraldmlfilhadheqncststvrlvgs
sranlftsisgginalwgplhgganqavlemlegirdsgddvsenydprarivkeqadki
lgddsllgiakeleeavdfytgliyralgfptrmftvlfalgrlpgwiahwremhdegds
kigrprqiytgyterdyvti

SCOPe Domain Coordinates for d4tvma_:

Click to download the PDB-style file with coordinates for d4tvma_.
(The format of our PDB-style files is described here.)

Timeline for d4tvma_: