SCOP 1.75: Domain d1qs8b_: 1qs8 B:

Lineage for d1qs8b_ (1qs8 B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (3 families)

5. Family b.50.1.2: Pepsin-like [50646] (10 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)

7. Species Plasmodium vivax [TaxId:5855] [50675] (2 PDB entries)

8. Domain d1qs8b_: 1qs8 B: [26888]
   complexed with act, iva, sta

Details for d1qs8b_

PDB Entry: 1qs8, 2.5 Å

PDB Description: Crystal structure of the P. vivax aspartic proteinase plasmepsin complexed with the inhibitor pepstatin A

PDB Compounds: (B:) plasmepsin

SCOP Domain Sequences for d1qs8b_:

Sequence; same for both SEQRES and ATOM records:

>d1qs8b_ b.50.1.2 (B:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]}
gsendvielddvanimfygegevgdnhqkfmlifdtgsanlwvpskkcnssgcsiknlyd
ssksksyekdgtkvditygsgtvkgffskdlvtlghlsmpykfievidtddlepiyssve
fdgilglgwkdlsigsidpivvelknqnkidnalftfylpvhdvhagyltiggieekfye
gnityeklnhdlywqidldvhfgkqtmekanvivdsgtttitapseflnkffanlnvikv
pflpfyvttcdnkemptlefksanntytlepeyymnpilevddtlcmitmlpvdidsntf
ilgdpfmrkyftvfdydkesvgfaiakn

Timeline for d1qs8b_:

• d1qs8b_ first appeared (with stable ids) in SCOP 1.55
  
• d1qs8b_ appears in SCOP 1.73
  
• d1qs8b_ appears in SCOPe 2.01
  
• d1qs8b_ appears in the current release, SCOPe 2.08