Lineage for d1qs8b_ (1qs8 B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562942Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 562943Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 563392Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 563562Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 563581Species Plasmodium vivax [TaxId:5855] [50675] (2 PDB entries)
  8. 563583Domain d1qs8b_: 1qs8 B: [26888]
    complexed with act, iva, sta

Details for d1qs8b_

PDB Entry: 1qs8 (more details), 2.5 Å

PDB Description: Crystal structure of the P. vivax aspartic proteinase plasmepsin complexed with the inhibitor pepstatin A

SCOP Domain Sequences for d1qs8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qs8b_ b.50.1.2 (B:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax}
gsendvielddvanimfygegevgdnhqkfmlifdtgsanlwvpskkcnssgcsiknlyd
ssksksyekdgtkvditygsgtvkgffskdlvtlghlsmpykfievidtddlepiyssve
fdgilglgwkdlsigsidpivvelknqnkidnalftfylpvhdvhagyltiggieekfye
gnityeklnhdlywqidldvhfgkqtmekanvivdsgtttitapseflnkffanlnvikv
pflpfyvttcdnkemptlefksanntytlepeyymnpilevddtlcmitmlpvdidsntf
ilgdpfmrkyftvfdydkesvgfaiakn

SCOP Domain Coordinates for d1qs8b_:

Click to download the PDB-style file with coordinates for d1qs8b_.
(The format of our PDB-style files is described here.)

Timeline for d1qs8b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qs8a_