Lineage for d1qs8b_ (1qs8 B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) 
Protein Plasmepsin ii (a hemoglobin-degrading enzyme) [50673] (2 species) 
Species Plasmodium vivax [TaxId:5855] [50675] (1 PDB entry) 
Domain d1qs8b_: 1qs8 B: [26888]
Details for d1qs8b_
PDB Entry: 1qs8 (more details), 2.5 Å
PDB Description: Crystal structure of the P. vivax aspartic proteinase plasmepsin complexed with the inhibitor pepstatin A
SCOP Domain Sequences for d1qs8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qs8b_ b.50.1.2 (B:) Plasmepsin ii (a hemoglobin-degrading enzyme) {Plasmodium vivax}
gsendvielddvanimfygegevgdnhqkfmlifdtgsanlwvpskkcnssgcsiknlyd
ssksksyekdgtkvditygsgtvkgffskdlvtlghlsmpykfievidtddlepiyssve
fdgilglgwkdlsigsidpivvelknqnkidnalftfylpvhdvhagyltiggieekfye
gnityeklnhdlywqidldvhfgkqtmekanvivdsgtttitapseflnkffanlnvikv
pflpfyvttcdnkemptlefksanntytlepeyymnpilevddtlcmitmlpvdidsntf
ilgdpfmrkyftvfdydkesvgfaiakn
SCOP Domain Coordinates for d1qs8b_:
Click to download the PDB-style file with coordinates for d1qs8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qs8b_:
- d1qs8b_ appears in SCOP 1.57
- d1qs8b_ appears in the current release, SCOPe 2.08
View in 3D
