Lineage for d4tvob1 (4tvo B:5-157)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095455Species Mycobacterium tuberculosis [TaxId:83332] [186789] (7 PDB entries)
  8. 2095458Domain d4tvob1: 4tvo B:5-157 [268879]
    Other proteins in same PDB: d4tvoa2, d4tvoa3, d4tvob2
    automated match to d1bdma1
    complexed with na, so4

Details for d4tvob1

PDB Entry: 4tvo (more details), 1.5 Å

PDB Description: Structure of Malate Dehydrogenase from Mycobacterium tuberculosis
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d4tvob1:

Sequence, based on SEQRES records: (download)

>d4tvob1 c.2.1.0 (B:5-157) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
splkvavtgaagqigysllfrlasgsllgpdrpielrlleiepalqalegvvmelddcaf
pllsgveigsdpqkifdgvslallvgarprgagmersdlleangaiftaqgkalnavaad
dvrvgvtgnpantnaliamtnapdiprerfsal

Sequence, based on observed residues (ATOM records): (download)

>d4tvob1 c.2.1.0 (B:5-157) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
splkvavtgaagqigysllfrlasgsllgpdrpielrlleiepalqalegvvmelddcaf
pllsgveigsdpqkifdgvslallvgarplleangaiftaqgkalnavaaddvrvgvtgn
pantnaliamtnapdiprerfsal

SCOPe Domain Coordinates for d4tvob1:

Click to download the PDB-style file with coordinates for d4tvob1.
(The format of our PDB-style files is described here.)

Timeline for d4tvob1: