SCOPe 2.08: Domain d4tvob1: 4tvo B:5-157

Lineage for d4tvob1 (4tvo B:5-157)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [186789] (19 PDB entries)

8. Domain d4tvob1: 4tvo B:5-157 [268879]
   Other proteins in same PDB: d4tvoa2, d4tvoa3, d4tvob2
   automated match to d1bdma1
   complexed with na, so4

Details for d4tvob1

PDB Entry: 4tvo, 1.5 Å

PDB Description: Structure of Malate Dehydrogenase from Mycobacterium tuberculosis

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d4tvob1:

Sequence, based on SEQRES records:

>d4tvob1 c.2.1.0 (B:5-157) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
splkvavtgaagqigysllfrlasgsllgpdrpielrlleiepalqalegvvmelddcaf
pllsgveigsdpqkifdgvslallvgarprgagmersdlleangaiftaqgkalnavaad
dvrvgvtgnpantnaliamtnapdiprerfsal

Sequence, based on observed residues (ATOM records):

>d4tvob1 c.2.1.0 (B:5-157) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
splkvavtgaagqigysllfrlasgsllgpdrpielrlleiepalqalegvvmelddcaf
pllsgveigsdpqkifdgvslallvgarplleangaiftaqgkalnavaaddvrvgvtgn
pantnaliamtnapdiprerfsal

Timeline for d4tvob1:

• d4tvob1 first appeared in SCOPe 2.05
  
• d4tvob1 appears in SCOPe 2.07