Lineage for d4ttts_ (4ttt S:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953691Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 1953692Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 1953832Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 1953833Protein automated matches [191172] (5 species)
    not a true protein
  7. 1953864Species Ralstonia eutropha [TaxId:381666] [256057] (5 PDB entries)
  8. 1953869Domain d4ttts_: 4ttt S: [268874]
    Other proteins in same PDB: d4tttl_
    automated match to d3rgws_
    complexed with cl, f3s, f4s, mg, na, nfv, po4, sf4

Details for d4ttts_

PDB Entry: 4ttt (more details), 1.72 Å

PDB Description: crystal structure of an o2-tolerant [nife]-hydrogenase from ralstonia eutropha in its as-isolated form - oxidized state 3
PDB Compounds: (S:) Uptake hydrogenase small subunit hoxK

SCOPe Domain Sequences for d4ttts_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ttts_ e.19.1.0 (S:) automated matches {Ralstonia eutropha [TaxId: 381666]}
prtpvlwlhglectccsesfirsahplakdvvlsmisldyddtlmaaaghqaeaileeim
tkykgnyilavegnpplnqdgmsciiggrpfieqlkyvakdakaiiswgscaswgcvqaa
kpnptqatpvhkvitdkpiikvpgcppiaevmtgvitymltfdripeldrqgrpkmfysq
rihdkcyrrphfdagqfveewddesarkgfclykmgckgpttynacsttrwnegtsfpiq
sghgcigcsedgfwdkgsfydrltgisqf

SCOPe Domain Coordinates for d4ttts_:

Click to download the PDB-style file with coordinates for d4ttts_.
(The format of our PDB-style files is described here.)

Timeline for d4ttts_: