Lineage for d1qs8a_ (1qs8 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15989Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 16118Protein Plasmepsin ii (a hemoglobin-degrading enzyme) [50673] (2 species)
  7. 16126Species Plasmodium vivax [TaxId:5855] [50675] (1 PDB entry)
  8. 16127Domain d1qs8a_: 1qs8 A: [26887]

Details for d1qs8a_

PDB Entry: 1qs8 (more details), 2.5 Å

PDB Description: Crystal structure of the P. vivax aspartic proteinase plasmepsin complexed with the inhibitor pepstatin A

SCOP Domain Sequences for d1qs8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qs8a_ b.50.1.2 (A:) Plasmepsin ii (a hemoglobin-degrading enzyme) {Plasmodium vivax}
sendvielddvanimfygegevgdnhqkfmlifdtgsanlwvpskkcnssgcsiknlyds
sksksyekdgtkvditygsgtvkgffskdlvtlghlsmpykfievidtddlepiyssvef
dgilglgwkdlsigsidpivvelknqnkidnalftfylpvhdvhagyltiggieekfyeg
nityeklnhdlywqidldvhfgkqtmekanvivdsgtttitapseflnkffanlnvikvp
flpfyvttcdnkemptlefksanntytlepeyymnpilevddtlcmitmlpvdidsntfi
lgdpfmrkyftvfdydkesvgfaiakn

SCOP Domain Coordinates for d1qs8a_:

Click to download the PDB-style file with coordinates for d1qs8a_.
(The format of our PDB-style files is described here.)

Timeline for d1qs8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qs8b_