SCOPe 2.02: Domain d1smeb_: 1sme B:

Lineage for d1smeb_ (1sme B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)

7. Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (18 PDB entries)

8. Domain d1smeb_: 1sme B: [26886]

Details for d1smeb_

PDB Entry: 1sme, 2.7 Å

PDB Description: plasmepsin ii, a hemoglobin-degrading enzyme from plasmodium falciparum, in complex with pepstatin a

PDB Compounds: (B:) plasmepsin II

SCOPe Domain Sequences for d1smeb_:

Sequence; same for both SEQRES and ATOM records:

>d1smeb_ b.50.1.2 (B:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

Timeline for d1smeb_:

• d1smeb_ first appeared (with stable ids) in SCOP 1.55
  
• d1smeb_ appears in SCOPe 2.01
  
• d1smeb_ appears in SCOPe 2.03
  
• d1smeb_ appears in the current release, SCOPe 2.08