Lineage for d4s17c1 (4s17 C:3-105)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934813Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2934938Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 2934939Protein automated matches [226862] (5 species)
    not a true protein
  7. 2935001Species Bifidobacterium adolescentis [TaxId:367928] [268844] (1 PDB entry)
  8. 2935004Domain d4s17c1: 4s17 C:3-105 [268859]
    Other proteins in same PDB: d4s17a2, d4s17b2, d4s17c2, d4s17d2, d4s17e2, d4s17f2
    automated match to d1htqa1
    complexed with act, mg

Details for d4s17c1

PDB Entry: 4s17 (more details), 2.3 Å

PDB Description: the crystal structure of glutamine synthetase from bifidobacterium adolescentis atcc 15703
PDB Compounds: (C:) glutamine synthetase

SCOPe Domain Sequences for d4s17c1:

Sequence, based on SEQRES records: (download)

>d4s17c1 d.15.9.0 (C:3-105) automated matches {Bifidobacterium adolescentis [TaxId: 367928]}
aletkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgssvegf
qainesdmklvpdvstafidpfrkhktldvafsivdpltdepy

Sequence, based on observed residues (ATOM records): (download)

>d4s17c1 d.15.9.0 (C:3-105) automated matches {Bifidobacterium adolescentis [TaxId: 367928]}
aletkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgssvegf
qsdmklvpdvstafidpfrkhktldvafsivdpltdepy

SCOPe Domain Coordinates for d4s17c1:

Click to download the PDB-style file with coordinates for d4s17c1.
(The format of our PDB-style files is described here.)

Timeline for d4s17c1: