SCOPe 2.06: Domain d4s1ma_: 4s1m A:

Lineage for d4s1ma_ (4s1m A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (40 species)
   not a true protein

7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [268849] (3 PDB entries)

8. Domain d4s1ma_: 4s1m A: [268858]
   automated match to d1td2a_
   complexed with mg

Details for d4s1ma_

PDB Entry: 4s1m, 1.64 Å

PDB Description: crystal structure of pyridoxal kinase from entamoeba histolytica

PDB Compounds: (A:) Pyridoxal kinase

SCOPe Domain Sequences for d4s1ma_:

Sequence; same for both SEQRES and ATOM records:

>d4s1ma_ c.72.1.0 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
mtnkvltissyvcsgfvgnrcgmiildsfqiqsifvltthlanhtgypvvggsgvllndf
isimdslevnhldkdieflvtgyfpssdlvyetinrvkrikdnkkvyflcdpilgdngkm
ytksevqdsmkelikyadiitpnatelsfltglevnsvseaikachilheqgipvilvts
ikegndiillcsfkdtlnnknftikipriegdftgvgdtltyillswiikgiplehavnr
aistlqtilrntvgtaeiniincipylkgteesftityi

Timeline for d4s1ma_:

• d4s1ma_ first appeared in SCOPe 2.05
  
• d4s1ma_ appears in SCOPe 2.07
  
• d4s1ma_ appears in the current release, SCOPe 2.08