Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
Superfamily c.65.1: Formyltransferase [53328] (2 families) |
Family c.65.1.0: automated matches [191608] (1 protein) not a true family |
Protein automated matches [191110] (11 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:170187] [268856] (1 PDB entry) |
Domain d4s1na_: 4s1n A: [268857] automated match to d3av3a_ complexed with cl |
PDB Entry: 4s1n (more details), 2.7 Å
SCOPe Domain Sequences for d4s1na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s1na_ c.65.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]} mkkiavfasgngsnfqviaeefpvefvfsdhrdayvlerakqlgvlsyafelkefeskad yeaalvelleehqidlvclagymkivgptllsayegrivnihpaylpefpgahgiedawn agvgqsgvtihwvdsgvdtgqvikqvrvprladdtidrfeariheaeyrlypevvkalft
Timeline for d4s1na_: