Lineage for d4rzja_ (4rzj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000147Protein automated matches [190420] (9 species)
    not a true protein
  7. 3000185Species Momordica balsamina [TaxId:3672] [189375] (73 PDB entries)
  8. 3000256Domain d4rzja_: 4rzj A: [268852]
    automated match to d4dwma_
    complexed with gol, nag

Details for d4rzja_

PDB Entry: 4rzj (more details), 1.98 Å

PDB Description: structure of the complex of type 1 ribosome inactivating protein from momordica balsamina with n-acetylglucosamine at 1.98 angstrom resolution using crystals grown in different conditions
PDB Compounds: (A:) Ribosome inactivating protein

SCOPe Domain Sequences for d4rzja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rzja_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d4rzja_:

Click to download the PDB-style file with coordinates for d4rzja_.
(The format of our PDB-style files is described here.)

Timeline for d4rzja_: