Lineage for d1smea_ (1sme A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060885Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 2060886Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries)
  8. 2060912Domain d1smea_: 1sme A: [26885]

Details for d1smea_

PDB Entry: 1sme (more details), 2.7 Å

PDB Description: plasmepsin ii, a hemoglobin-degrading enzyme from plasmodium falciparum, in complex with pepstatin a
PDB Compounds: (A:) plasmepsin II

SCOPe Domain Sequences for d1smea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smea_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

SCOPe Domain Coordinates for d1smea_:

Click to download the PDB-style file with coordinates for d1smea_.
(The format of our PDB-style files is described here.)

Timeline for d1smea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1smeb_