Lineage for d1pfzd_ (1pfz D:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61252Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 61253Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 61569Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 61704Protein Plasmepsin ii (a hemoglobin-degrading enzyme) [50673] (2 species)
  7. 61705Species Plasmodium falciparum [50674] (3 PDB entries)
  8. 61709Domain d1pfzd_: 1pfz D: [26884]

Details for d1pfzd_

PDB Entry: 1pfz (more details), 1.85 Å

PDB Description: proplasmepsin ii from plasmodium falciparum

SCOP Domain Sequences for d1pfzd_:

Sequence, based on SEQRES records: (download)

>d1pfzd_ b.50.1.2 (D:) Plasmepsin ii (a hemoglobin-degrading enzyme) {Plasmodium falciparum}
hltigfkvenahdrilktikthklknyikesvnflnsgltktnylgssndnielvdfqni
mfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssksrtyekdgtkve
mnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastfdgilglgwkdlsig
svdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyegpltyeklnhdlywq
itldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpflpfyvtlcnnskl
ptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdpfmrkyftvfd
ydnhsvgialakknl

Sequence, based on observed residues (ATOM records): (download)

>d1pfzd_ b.50.1.2 (D:) Plasmepsin ii (a hemoglobin-degrading enzyme) {Plasmodium falciparum}
hltigfkvenahdrilktikthklknyikesvnflnsgltktnylgssndnielvdfqni
mfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssksrtyekdgtkve
mvsgffskdlvtvgnlslpykfievidtngfeptytastfdgilglgwkdlsigsvdpiv
velknqnkienalftfylpvhdkhtgfltiggieerfyegpltyeklnhdlywqitldah
vgnimlekancivdsgtsaitvptdflnkmlqnldvikvpflpfyvtlcnnsklptfeft
sengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdpfmrkyftvfdydnhsv
gialakknl

SCOP Domain Coordinates for d1pfzd_:

Click to download the PDB-style file with coordinates for d1pfzd_.
(The format of our PDB-style files is described here.)

Timeline for d1pfzd_: