Lineage for d1pfzd_ (1pfz D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2392462Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2393658Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 2393659Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries)
  8. 2393666Domain d1pfzd_: 1pfz D: [26884]
    complexed with gol

Details for d1pfzd_

PDB Entry: 1pfz (more details), 1.85 Å

PDB Description: proplasmepsin ii from plasmodium falciparum
PDB Compounds: (D:) proplasmepsin II

SCOPe Domain Sequences for d1pfzd_:

Sequence, based on SEQRES records: (download)

>d1pfzd_ b.50.1.2 (D:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
hltigfkvenahdrilktikthklknyikesvnflnsgltktnylgssndnielvdfqni
mfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssksrtyekdgtkve
mnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastfdgilglgwkdlsig
svdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyegpltyeklnhdlywq
itldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpflpfyvtlcnnskl
ptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdpfmrkyftvfd
ydnhsvgialakknl

Sequence, based on observed residues (ATOM records): (download)

>d1pfzd_ b.50.1.2 (D:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
hltigfkvenahdrilktikthklknyikesvnflnsgltktnylgssndnielvdfqni
mfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssksrtyekdgtkve
mvsgffskdlvtvgnlslpykfievidtngfeptytastfdgilglgwkdlsigsvdpiv
velknqnkienalftfylpvhdkhtgfltiggieerfyegpltyeklnhdlywqitldah
vgnimlekancivdsgtsaitvptdflnkmlqnldvikvpflpfyvtlcnnsklptfeft
sengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdpfmrkyftvfdydnhsv
gialakknl

SCOPe Domain Coordinates for d1pfzd_:

Click to download the PDB-style file with coordinates for d1pfzd_.
(The format of our PDB-style files is described here.)

Timeline for d1pfzd_: